Anti SCML4 pAb (ATL-HPA065958)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065958-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SCML4
Alternative Gene Name: dJ47M23.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044770: 56%, ENSRNOG00000026110: 65%
Entrez Gene ID: 256380
Uniprot ID: Q8N228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGD |
Gene Sequence | CSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGD |
Gene ID - Mouse | ENSMUSG00000044770 |
Gene ID - Rat | ENSRNOG00000026110 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SCML4 pAb (ATL-HPA065958) | |
Datasheet | Anti SCML4 pAb (ATL-HPA065958) Datasheet (External Link) |
Vendor Page | Anti SCML4 pAb (ATL-HPA065958) at Atlas Antibodies |
Documents & Links for Anti SCML4 pAb (ATL-HPA065958) | |
Datasheet | Anti SCML4 pAb (ATL-HPA065958) Datasheet (External Link) |
Vendor Page | Anti SCML4 pAb (ATL-HPA065958) |