Anti SCLT1 pAb (ATL-HPA036560)

Atlas Antibodies

Catalog No.: ATL-HPA036560-25

Protein Description: sodium channel and clathrin linker 1
Gene Name: SCLT1
Alternative Gene Name: FLJ30655, hCAP-1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059834: 92%, ENSRNOG00000014139: 92%
Entrez Gene ID: 132320
Uniprot ID: Q96NL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STMEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKSELSRQKLHTQELLSQLEMANEK
• Gene Sequence: STMEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKSELSRQKLHTQELLSQLEMANEK
• Gene ID - Mouse: ENSMUSG00000059834
• Gene ID - Rat: ENSRNOG00000014139
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCLT1 pAb (ATL-HPA036560) – 1 Found

Jenks, Andrew D; Vyse, Simon; Wong, Jocelyn P; Kostaras, Eleftherios; Keller, Deborah; Burgoyne, Thomas; Shoemark, Amelia; Tsalikis, Athanasios; de la Roche, Maike; Michaelis, Martin; Cinatl, Jindrich Jr; Huang, Paul H; Tanos, Barbara E. Primary Cilia Mediate Diverse Kinase Inhibitor Resistance Mechanisms in Cancer. Cell Reports. 2018;23(10):3042-3055.