Anti SCGB2B2 pAb (ATL-HPA046806 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046806-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and SCGB2B2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422450).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: secretoglobin, family 2B, member 2
Gene Name: SCGB2B2
Alternative Gene Name: SCGB4A2, SCGBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022377: 23%, ENSRNOG00000058733: 23%
Entrez Gene ID: 284402
Uniprot ID: Q4G0G5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLDIDKLLANVVFDVSQDLLKEELARYNPSPLTEESFLNVQQCFANVSVTERFAHSVVIKKILQSNDCIEAAF
Gene Sequence CLDIDKLLANVVFDVSQDLLKEELARYNPSPLTEESFLNVQQCFANVSVTERFAHSVVIKKILQSNDCIEAAF
Gene ID - Mouse ENSMUSG00000022377
Gene ID - Rat ENSRNOG00000058733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SCGB2B2 pAb (ATL-HPA046806 w/enhanced validation)
Datasheet Anti SCGB2B2 pAb (ATL-HPA046806 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCGB2B2 pAb (ATL-HPA046806 w/enhanced validation)