Anti SCGB1D2 pAb (ATL-HPA035318)

Atlas Antibodies

Catalog No.: ATL-HPA035318-25

Protein Description: secretoglobin, family 1D, member 2
Gene Name: SCGB1D2
Alternative Gene Name: LIPB, LPHB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037731: 27%, ENSRNOG00000020294: 45%
Entrez Gene ID: 10647
Uniprot ID: O95969
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCS
• Gene Sequence: FCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCS
• Gene ID - Mouse: ENSMUSG00000037731
• Gene ID - Rat: ENSRNOG00000020294
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.