Anti SCG5 pAb (ATL-HPA013136 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA013136-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: secretogranin V (7B2 protein)
Gene Name: SCG5
Alternative Gene Name: 7B2, SGNE1, SgV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023236: 96%, ENSRNOG00000007542: 96%
Entrez Gene ID: 6447
Uniprot ID: P05408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSV
Gene Sequence EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSV
Gene ID - Mouse ENSMUSG00000023236
Gene ID - Rat ENSRNOG00000007542
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCG5 pAb (ATL-HPA013136 w/enhanced validation)
Datasheet Anti SCG5 pAb (ATL-HPA013136 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCG5 pAb (ATL-HPA013136 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SCG5 pAb (ATL-HPA013136 w/enhanced validation)
Datasheet Anti SCG5 pAb (ATL-HPA013136 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCG5 pAb (ATL-HPA013136 w/enhanced validation)
Citations for Anti SCG5 pAb (ATL-HPA013136 w/enhanced validation) – 1 Found
Lindskog, Cecilia; Korsgren, Olle; Pontén, Fredrik; Eriksson, Jan W; Johansson, Lars; Danielsson, Angelika. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. Journal Of Proteomics. 2012;75(9):2611-20.  PubMed