Anti SCAMP5 pAb (ATL-HPA046645 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046645-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: SCAMP5
Alternative Gene Name: MGC24969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040722: 100%, ENSRNOG00000054008: 100%
Entrez Gene ID: 192683
Uniprot ID: Q8TAC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE |
Gene Sequence | GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE |
Gene ID - Mouse | ENSMUSG00000040722 |
Gene ID - Rat | ENSRNOG00000054008 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SCAMP5 pAb (ATL-HPA046645 w/enhanced validation) | |
Datasheet | Anti SCAMP5 pAb (ATL-HPA046645 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SCAMP5 pAb (ATL-HPA046645 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SCAMP5 pAb (ATL-HPA046645 w/enhanced validation) | |
Datasheet | Anti SCAMP5 pAb (ATL-HPA046645 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SCAMP5 pAb (ATL-HPA046645 w/enhanced validation) |