Anti SCAF1 pAb (ATL-HPA054593)

Atlas Antibodies

Catalog No.:
ATL-HPA054593-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SR-related CTD-associated factor 1
Gene Name: SCAF1
Alternative Gene Name: FLJ00034, SR-A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038406: 94%, ENSRNOG00000056946: 95%
Entrez Gene ID: 58506
Uniprot ID: Q9H7N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PASRVSQLPTLPPPMPWNLPAGVDCTTSGVLALTALLFKMEEANLASRAKAQELIQATNQILSHRKPPSSLGMTPAPVPTSLGLP
Gene Sequence PASRVSQLPTLPPPMPWNLPAGVDCTTSGVLALTALLFKMEEANLASRAKAQELIQATNQILSHRKPPSSLGMTPAPVPTSLGLP
Gene ID - Mouse ENSMUSG00000038406
Gene ID - Rat ENSRNOG00000056946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCAF1 pAb (ATL-HPA054593)
Datasheet Anti SCAF1 pAb (ATL-HPA054593) Datasheet (External Link)
Vendor Page Anti SCAF1 pAb (ATL-HPA054593) at Atlas Antibodies

Documents & Links for Anti SCAF1 pAb (ATL-HPA054593)
Datasheet Anti SCAF1 pAb (ATL-HPA054593) Datasheet (External Link)
Vendor Page Anti SCAF1 pAb (ATL-HPA054593)