Anti SACM1L pAb (ATL-HPA069869)

Atlas Antibodies

Catalog No.:
ATL-HPA069869-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SAC1 suppressor of actin mutations 1-like (yeast)
Gene Name: SACM1L
Alternative Gene Name: KIAA0851, SAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025240: 98%, ENSRNOG00000005149: 100%
Entrez Gene ID: 22908
Uniprot ID: Q9NTJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKT
Gene Sequence NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKT
Gene ID - Mouse ENSMUSG00000025240
Gene ID - Rat ENSRNOG00000005149
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SACM1L pAb (ATL-HPA069869)
Datasheet Anti SACM1L pAb (ATL-HPA069869) Datasheet (External Link)
Vendor Page Anti SACM1L pAb (ATL-HPA069869) at Atlas Antibodies

Documents & Links for Anti SACM1L pAb (ATL-HPA069869)
Datasheet Anti SACM1L pAb (ATL-HPA069869) Datasheet (External Link)
Vendor Page Anti SACM1L pAb (ATL-HPA069869)
Citations for Anti SACM1L pAb (ATL-HPA069869) – 1 Found
Kutchukian, Candice; Vivas, Oscar; Casas, Maria; Jones, Julia G; Tiscione, Scott A; Simó, Sergi; Ory, Daniel S; Dixon, Rose E; Dickson, Eamonn J. NPC1 regulates the distribution of phosphatidylinositol 4-kinases at Golgi and lysosomal membranes. The Embo Journal. 2021;40(13):e105990.  PubMed