Anti SACM1L pAb (ATL-HPA069869)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069869-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SACM1L
Alternative Gene Name: KIAA0851, SAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025240: 98%, ENSRNOG00000005149: 100%
Entrez Gene ID: 22908
Uniprot ID: Q9NTJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKT |
Gene Sequence | NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKT |
Gene ID - Mouse | ENSMUSG00000025240 |
Gene ID - Rat | ENSRNOG00000005149 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SACM1L pAb (ATL-HPA069869) | |
Datasheet | Anti SACM1L pAb (ATL-HPA069869) Datasheet (External Link) |
Vendor Page | Anti SACM1L pAb (ATL-HPA069869) at Atlas Antibodies |
Documents & Links for Anti SACM1L pAb (ATL-HPA069869) | |
Datasheet | Anti SACM1L pAb (ATL-HPA069869) Datasheet (External Link) |
Vendor Page | Anti SACM1L pAb (ATL-HPA069869) |
Citations for Anti SACM1L pAb (ATL-HPA069869) – 1 Found |
Kutchukian, Candice; Vivas, Oscar; Casas, Maria; Jones, Julia G; Tiscione, Scott A; Simó, Sergi; Ory, Daniel S; Dixon, Rose E; Dickson, Eamonn J. NPC1 regulates the distribution of phosphatidylinositol 4-kinases at Golgi and lysosomal membranes. The Embo Journal. 2021;40(13):e105990. PubMed |