Anti S100A9 pAb (ATL-HPA004193 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004193-25

Protein Description: S100 calcium binding protein A9
Gene Name: S100A9
Alternative Gene Name: 60B8AG, CAGB, CFAG, CGLB, LIAG, MAC387, MIF, MRP14, NIF, P14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056071: 59%, ENSRNOG00000011483: 64%
Entrez Gene ID: 6280
Uniprot ID: P06702
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG
• Gene Sequence: CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG
• Gene ID - Mouse: ENSMUSG00000056071
• Gene ID - Rat: ENSRNOG00000011483
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti S100A9 pAb (ATL-HPA004193 w/enhanced validation) – 3 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Zhao, Yu Xing; Zhu, Hui Juan; Pan, Hui; Liu, Xue Mei; Wang, Lin Jie; Yang, Hong Bo; Li, Nai Shi; Gong, Feng Ying; Sun, Wei; Zeng, Yong. Comparative Proteome Analysis of Epicardial and Subcutaneous Adipose Tissues from Patients with or without Coronary Artery Disease. International Journal Of Endocrinology. 2019( 31534454):6976712. 

Maus, Rachel L G; Jakub, James W; Hieken, Tina J; Nevala, Wendy K; Christensen, Trace A; Sutor, Shari L; Flotte, Thomas J; Markovic, Svetomir N. Identification of novel, immune-mediating extracellular vesicles in human lymphatic effluent draining primary cutaneous melanoma. Oncoimmunology. 8(12):e1667742.