Anti S100A8 pAb (ATL-HPA024372 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024372-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: S100A8
Alternative Gene Name: 60B8AG, CAGA, CFAG, CGLA, MRP8, P8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056054: 56%, ENSRNOG00000011557: 60%
Entrez Gene ID: 6279
Uniprot ID: P05109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM |
| Gene Sequence | LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM |
| Gene ID - Mouse | ENSMUSG00000056054 |
| Gene ID - Rat | ENSRNOG00000011557 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti S100A8 pAb (ATL-HPA024372 w/enhanced validation) | |
| Datasheet | Anti S100A8 pAb (ATL-HPA024372 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti S100A8 pAb (ATL-HPA024372 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti S100A8 pAb (ATL-HPA024372 w/enhanced validation) | |
| Datasheet | Anti S100A8 pAb (ATL-HPA024372 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti S100A8 pAb (ATL-HPA024372 w/enhanced validation) |
| Citations for Anti S100A8 pAb (ATL-HPA024372 w/enhanced validation) – 5 Found |
| Ellis, Crystal N; LaRocque, Regina C; Uddin, Taher; Krastins, Bryan; Mayo-Smith, Leslie M; Sarracino, David; Karlsson, Elinor K; Rahman, Atiqur; Shirin, Tahmina; Bhuiyan, Taufiqur R; Chowdhury, Fahima; Khan, Ashraful Islam; Ryan, Edward T; Calderwood, Stephen B; Qadri, Firdausi; Harris, Jason B. Comparative proteomic analysis reveals activation of mucosal innate immune signaling pathways during cholera. Infection And Immunity. 2015;83(3):1089-103. PubMed |
| Béke, Gabriella; Dajnoki, Zsolt; Kapitány, Anikó; Gáspár, Krisztián; Medgyesi, Barbara; Póliska, Szilárd; Hendrik, Zoltán; Péter, Zoltán; Törőcsik, Dániel; Bíró, Tamás; Szegedi, Andrea. Immunotopographical Differences of Human Skin. Frontiers In Immunology. 9( 29556238):424. PubMed |
| Sun, Zhiwei; Zeng, Bin; Liu, Doudou; Zhao, Qiting; Wang, Jianyu; Rosie Xing, H. S100A8 transported by SEC23A inhibits metastatic colonization via autocrine activation of autophagy. Cell Death & Disease. 2020;11(8):650. PubMed |
| Zhang, Li; Zhou, Shixia; Zhou, Tiejun; Yuan, Kaifeng; Li, Xiaoming; Tang, Junling. S100A8 promotes chemoresistance via augmenting autophagy in B‑cell lymphoma cells. Oncology Reports. 2021;45(1):151-158. PubMed |
| Dajnoki, Z; Somogyi, O; Medgyesi, B; Jenei, A; Szabó, L; Gáspár, K; Hendrik, Z; Gergely, P; Imre, D; Póliska, S; Törőcsik, D; Zouboulis, C C; Prens, E P; Kapitány, A; Szegedi, A. Primary alterations during the development of hidradenitis suppurativa. Journal Of The European Academy Of Dermatology And Venereology : Jeadv. 2022;36(3):462-471. PubMed |