Anti S100A7 pAb (ATL-HPA006997)

Atlas Antibodies

Catalog No.: ATL-HPA006997-25

Protein Description: S100 calcium binding protein A7
Gene Name: S100A7
Alternative Gene Name: PSOR1, S100A7c
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063767: 30%, ENSRNOG00000033352: 30%
Entrez Gene ID: 6278
Uniprot ID: P31151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
• Gene Sequence: EKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
• Gene ID - Mouse: ENSMUSG00000063767
• Gene ID - Rat: ENSRNOG00000033352
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti S100A7 pAb (ATL-HPA006997) – 2 Found

Lee, Joanna Y; Chang, Jessica K; Dominguez, Antonia A; Lee, Hong-Pyo; Nam, Sungmin; Chang, Julie; Varma, Sushama; Qi, Lei S; West, Robert B; Chaudhuri, Ovijit. YAP-independent mechanotransduction drives breast cancer progression. Nature Communications. 2019;10(1):1848. 

Jardet, Claire; David, Anthony; Braun, Emilie; Descargues, Pascal; Grolleau, Jean-Louis; Hebsgaard, Josephine; Norsgaard, Hanne; Lovato, Paola. Development and characterization of a human Th17-driven ex vivo skin inflammation model. Experimental Dermatology. 2020;29(10):993-1003.