Anti RUFY4 pAb (ATL-HPA037980)

Atlas Antibodies

Catalog No.: ATL-HPA037980-25

Protein Description: RUN and FYVE domain containing 4
Gene Name: RUFY4
Alternative Gene Name: FLJ46536
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061815: 38%, ENSRNOG00000032991: 40%
Entrez Gene ID: 285180
Uniprot ID: Q6ZNE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KELQLDQEERAPWIEIFLGNSTPSTQGQGKGAMGTQKEVIGMEAEVTGVLLVAEGQRTTEGTHKKEAEWSHVQRLLMPSPR
• Gene Sequence: KELQLDQEERAPWIEIFLGNSTPSTQGQGKGAMGTQKEVIGMEAEVTGVLLVAEGQRTTEGTHKKEAEWSHVQRLLMPSPR
• Gene ID - Mouse: ENSMUSG00000061815
• Gene ID - Rat: ENSRNOG00000032991
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.