Anti RTTN pAb (ATL-HPA041967)

Atlas Antibodies

Catalog No.:
ATL-HPA041967-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: rotatin
Gene Name: RTTN
Alternative Gene Name: DKFZP434G145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023066: 81%, ENSRNOG00000038200: 86%
Entrez Gene ID: 25914
Uniprot ID: Q86VV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEEGADTKRPLIDARVLSRVTDLFIGKKPIELRLDDRRELVIKLETVEKVYEIFTSDDVDLVLGKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVV
Gene Sequence SEEGADTKRPLIDARVLSRVTDLFIGKKPIELRLDDRRELVIKLETVEKVYEIFTSDDVDLVLGKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVV
Gene ID - Mouse ENSMUSG00000023066
Gene ID - Rat ENSRNOG00000038200
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RTTN pAb (ATL-HPA041967)
Datasheet Anti RTTN pAb (ATL-HPA041967) Datasheet (External Link)
Vendor Page Anti RTTN pAb (ATL-HPA041967) at Atlas Antibodies

Documents & Links for Anti RTTN pAb (ATL-HPA041967)
Datasheet Anti RTTN pAb (ATL-HPA041967) Datasheet (External Link)
Vendor Page Anti RTTN pAb (ATL-HPA041967)