Anti RTP5 pAb (ATL-HPA050902)

Atlas Antibodies

Catalog No.:
ATL-HPA050902-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: receptor (chemosensory) transporter protein 5 (putative)
Gene Name: RTP5
Alternative Gene Name: C2orf85, CXXC11, FLJ33590, Z3CXXC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038256: 23%, ENSRNOG00000006460: 26%
Entrez Gene ID: 285093
Uniprot ID: Q14D33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSLTSIFTNTLSEPTDGPVATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGSLALPFPADVQGKDAFTD
Gene Sequence PSSLTSIFTNTLSEPTDGPVATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGSLALPFPADVQGKDAFTD
Gene ID - Mouse ENSMUSG00000038256
Gene ID - Rat ENSRNOG00000006460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RTP5 pAb (ATL-HPA050902)
Datasheet Anti RTP5 pAb (ATL-HPA050902) Datasheet (External Link)
Vendor Page Anti RTP5 pAb (ATL-HPA050902) at Atlas Antibodies

Documents & Links for Anti RTP5 pAb (ATL-HPA050902)
Datasheet Anti RTP5 pAb (ATL-HPA050902) Datasheet (External Link)
Vendor Page Anti RTP5 pAb (ATL-HPA050902)