Anti RTP5 pAb (ATL-HPA050902)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050902-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RTP5
Alternative Gene Name: C2orf85, CXXC11, FLJ33590, Z3CXXC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038256: 23%, ENSRNOG00000006460: 26%
Entrez Gene ID: 285093
Uniprot ID: Q14D33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSSLTSIFTNTLSEPTDGPVATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGSLALPFPADVQGKDAFTD |
| Gene Sequence | PSSLTSIFTNTLSEPTDGPVATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGSLALPFPADVQGKDAFTD |
| Gene ID - Mouse | ENSMUSG00000038256 |
| Gene ID - Rat | ENSRNOG00000006460 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RTP5 pAb (ATL-HPA050902) | |
| Datasheet | Anti RTP5 pAb (ATL-HPA050902) Datasheet (External Link) |
| Vendor Page | Anti RTP5 pAb (ATL-HPA050902) at Atlas Antibodies |
| Documents & Links for Anti RTP5 pAb (ATL-HPA050902) | |
| Datasheet | Anti RTP5 pAb (ATL-HPA050902) Datasheet (External Link) |
| Vendor Page | Anti RTP5 pAb (ATL-HPA050902) |