Anti RTN3 pAb (ATL-HPA015649 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015649-25

Protein Description: reticulon 3
Gene Name: RTN3
Alternative Gene Name: ASYIP, HAP, NSPL2, NSPLII, RTN3-A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024758: 55%, ENSRNOG00000021202: 48%
Entrez Gene ID: 10313
Uniprot ID: O95197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPQVKQQTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKPVPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDW
• Gene Sequence: VPQVKQQTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKPVPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDW
• Gene ID - Mouse: ENSMUSG00000024758
• Gene ID - Rat: ENSRNOG00000021202
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RTN3 pAb (ATL-HPA015649 w/enhanced validation) – 2 Found

Li, Binghua; Feng, Wendu; Luo, Ouyang; Xu, Tiancheng; Cao, Yajuan; Wu, Hongyan; Yu, Decai; Ding, Yitao. Development and Validation of a Three-gene Prognostic Signature for Patients with Hepatocellular Carcinoma. Scientific Reports. 2017;7(1):5517. 

Bedri, Sahl Khalid; Nilsson, Ola B; Fink, Katharina; Månberg, Anna; Hamsten, Carl; Ayoglu, Burcu; Manouchehrinia, Ali; Nilsson, Peter; Olsson, Tomas; Hillert, Jan; Grönlund, Hans; Glaser, Anna. Plasma protein profiling reveals candidate biomarkers for multiple sclerosis treatment. Plos One. 14(5):e0217208.