Anti RSPO1 pAb (ATL-HPA046154)

Atlas Antibodies

Catalog No.:
ATL-HPA046154-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: R-spondin 1
Gene Name: RSPO1
Alternative Gene Name: FLJ40906, RSPONDIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028871: 90%, ENSRNOG00000009656: 90%
Entrez Gene ID: 284654
Uniprot ID: Q2MKA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHA
Gene Sequence CKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHA
Gene ID - Mouse ENSMUSG00000028871
Gene ID - Rat ENSRNOG00000009656
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RSPO1 pAb (ATL-HPA046154)
Datasheet Anti RSPO1 pAb (ATL-HPA046154) Datasheet (External Link)
Vendor Page Anti RSPO1 pAb (ATL-HPA046154) at Atlas Antibodies

Documents & Links for Anti RSPO1 pAb (ATL-HPA046154)
Datasheet Anti RSPO1 pAb (ATL-HPA046154) Datasheet (External Link)
Vendor Page Anti RSPO1 pAb (ATL-HPA046154)
Citations for Anti RSPO1 pAb (ATL-HPA046154) – 1 Found
Zhang, Mingjun; Haughey, Michael; Wang, Nai-Yu; Blease, Kate; Kapoun, Ann M; Couto, Suzana; Belka, Igor; Hoey, Timothy; Groza, Matthew; Hartke, James; Bennett, Brydon; Cain, Jennifer; Gurney, Austin; Benish, Brent; Castiglioni, Paola; Drew, Clifton; Lachowicz, Jean; Carayannopoulos, Leon; Nathan, Steven D; Distler, Jorg; Brenner, David A; Hariharan, Kandasamy; Cho, Ho; Xie, Weilin. Targeting the Wnt signaling pathway through R-spondin 3 identifies an anti-fibrosis treatment strategy for multiple organs. Plos One. 15(3):e0229445.  PubMed