Anti RSPO1 pAb (ATL-HPA046154)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046154-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RSPO1
Alternative Gene Name: FLJ40906, RSPONDIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028871: 90%, ENSRNOG00000009656: 90%
Entrez Gene ID: 284654
Uniprot ID: Q2MKA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHA |
| Gene Sequence | CKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHA |
| Gene ID - Mouse | ENSMUSG00000028871 |
| Gene ID - Rat | ENSRNOG00000009656 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RSPO1 pAb (ATL-HPA046154) | |
| Datasheet | Anti RSPO1 pAb (ATL-HPA046154) Datasheet (External Link) |
| Vendor Page | Anti RSPO1 pAb (ATL-HPA046154) at Atlas Antibodies |
| Documents & Links for Anti RSPO1 pAb (ATL-HPA046154) | |
| Datasheet | Anti RSPO1 pAb (ATL-HPA046154) Datasheet (External Link) |
| Vendor Page | Anti RSPO1 pAb (ATL-HPA046154) |
| Citations for Anti RSPO1 pAb (ATL-HPA046154) – 1 Found |
| Zhang, Mingjun; Haughey, Michael; Wang, Nai-Yu; Blease, Kate; Kapoun, Ann M; Couto, Suzana; Belka, Igor; Hoey, Timothy; Groza, Matthew; Hartke, James; Bennett, Brydon; Cain, Jennifer; Gurney, Austin; Benish, Brent; Castiglioni, Paola; Drew, Clifton; Lachowicz, Jean; Carayannopoulos, Leon; Nathan, Steven D; Distler, Jorg; Brenner, David A; Hariharan, Kandasamy; Cho, Ho; Xie, Weilin. Targeting the Wnt signaling pathway through R-spondin 3 identifies an anti-fibrosis treatment strategy for multiple organs. Plos One. 15(3):e0229445. PubMed |