Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045382-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: radial spoke head 6 homolog A (Chlamydomonas)
Gene Name: RSPH6A
Alternative Gene Name: RSHL1, RSP4, RSP6, RSPH4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040866: 46%, ENSRNOG00000061526: 48%
Entrez Gene ID: 81492
Uniprot ID: Q9H0K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTTSLMLQRLQQGQSSLFQQLDPTFQEPPVNPLGQFNLYQTDQFSEGAQHGPYIRDDPALQFLPSELGFPHYSAQVP
Gene Sequence LTTSLMLQRLQQGQSSLFQQLDPTFQEPPVNPLGQFNLYQTDQFSEGAQHGPYIRDDPALQFLPSELGFPHYSAQVP
Gene ID - Mouse ENSMUSG00000040866
Gene ID - Rat ENSRNOG00000061526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation)
Datasheet Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation)
Datasheet Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation)
Citations for Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation) – 1 Found
Minucci, Sergio; Venditti, Massimo. New Insight on the In Vitro Effects of Melatonin in Preserving Human Sperm Quality. International Journal Of Molecular Sciences. 2022;23(9)  PubMed