Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031198-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: radial spoke head 4 homolog A (Chlamydomonas)
Gene Name: RSPH4A
Alternative Gene Name: CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039552: 66%, ENSRNOG00000047471: 67%
Entrez Gene ID: 345895
Uniprot ID: Q5TD94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI
Gene Sequence DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI
Gene ID - Mouse ENSMUSG00000039552
Gene ID - Rat ENSRNOG00000047471
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation)
Datasheet Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation)
Datasheet Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation)
Citations for Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) – 3 Found
Yoke, Hiroshi; Ueno, Hironori; Narita, Akihiro; Sakai, Takafumi; Horiuchi, Kahoru; Shingyoji, Chikako; Hamada, Hiroshi; Shinohara, Kyosuke. Rsph4a is essential for the triplet radial spoke head assembly of the mouse motile cilia. Plos Genetics. 2020;16(3):e1008664.  PubMed
McKenzie, Casey W; Lee, Lance. Genetic interaction between central pair apparatus genes CFAP221, CFAP54, and SPEF2 in mouse models of primary ciliary dyskinesia. Scientific Reports. 2020;10(1):12337.  PubMed
Ignatenko, Olesia; Malinen, Satu; Rybas, Sofiia; Vihinen, Helena; Nikkanen, Joni; Kononov, Aleksander; Jokitalo, Eija S; Ince-Dunn, Gulayse; Suomalainen, Anu. Mitochondrial dysfunction compromises ciliary homeostasis in astrocytes. The Journal Of Cell Biology. 2023;222(1)  PubMed