Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031198-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RSPH4A
Alternative Gene Name: CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039552: 66%, ENSRNOG00000047471: 67%
Entrez Gene ID: 345895
Uniprot ID: Q5TD94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI |
| Gene Sequence | DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI |
| Gene ID - Mouse | ENSMUSG00000039552 |
| Gene ID - Rat | ENSRNOG00000047471 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) | |
| Datasheet | Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) | |
| Datasheet | Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) |
| Citations for Anti RSPH4A pAb (ATL-HPA031198 w/enhanced validation) – 3 Found |
| Yoke, Hiroshi; Ueno, Hironori; Narita, Akihiro; Sakai, Takafumi; Horiuchi, Kahoru; Shingyoji, Chikako; Hamada, Hiroshi; Shinohara, Kyosuke. Rsph4a is essential for the triplet radial spoke head assembly of the mouse motile cilia. Plos Genetics. 2020;16(3):e1008664. PubMed |
| McKenzie, Casey W; Lee, Lance. Genetic interaction between central pair apparatus genes CFAP221, CFAP54, and SPEF2 in mouse models of primary ciliary dyskinesia. Scientific Reports. 2020;10(1):12337. PubMed |
| Ignatenko, Olesia; Malinen, Satu; Rybas, Sofiia; Vihinen, Helena; Nikkanen, Joni; Kononov, Aleksander; Jokitalo, Eija S; Ince-Dunn, Gulayse; Suomalainen, Anu. Mitochondrial dysfunction compromises ciliary homeostasis in astrocytes. The Journal Of Cell Biology. 2023;222(1) PubMed |