Anti RRM2B pAb (ATL-HPA028812)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028812-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RRM2B
Alternative Gene Name: p53R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022292: 67%, ENSRNOG00000025454: 67%
Entrez Gene ID: 50484
Uniprot ID: Q7LG56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV |
| Gene Sequence | MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV |
| Gene ID - Mouse | ENSMUSG00000022292 |
| Gene ID - Rat | ENSRNOG00000025454 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RRM2B pAb (ATL-HPA028812) | |
| Datasheet | Anti RRM2B pAb (ATL-HPA028812) Datasheet (External Link) |
| Vendor Page | Anti RRM2B pAb (ATL-HPA028812) at Atlas Antibodies |
| Documents & Links for Anti RRM2B pAb (ATL-HPA028812) | |
| Datasheet | Anti RRM2B pAb (ATL-HPA028812) Datasheet (External Link) |
| Vendor Page | Anti RRM2B pAb (ATL-HPA028812) |