Anti RRM2B pAb (ATL-HPA028812)

Atlas Antibodies

Catalog No.:
ATL-HPA028812-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribonucleotide reductase M2 B (TP53 inducible)
Gene Name: RRM2B
Alternative Gene Name: p53R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022292: 67%, ENSRNOG00000025454: 67%
Entrez Gene ID: 50484
Uniprot ID: Q7LG56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV
Gene Sequence MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV
Gene ID - Mouse ENSMUSG00000022292
Gene ID - Rat ENSRNOG00000025454
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RRM2B pAb (ATL-HPA028812)
Datasheet Anti RRM2B pAb (ATL-HPA028812) Datasheet (External Link)
Vendor Page Anti RRM2B pAb (ATL-HPA028812) at Atlas Antibodies

Documents & Links for Anti RRM2B pAb (ATL-HPA028812)
Datasheet Anti RRM2B pAb (ATL-HPA028812) Datasheet (External Link)
Vendor Page Anti RRM2B pAb (ATL-HPA028812)