Anti RPUSD4 pAb (ATL-HPA039689)

Atlas Antibodies

Catalog No.: ATL-HPA039689-25

Protein Description: RNA pseudouridylate synthase domain containing 4
Gene Name: RPUSD4
Alternative Gene Name: FLJ14494
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032044: 94%, ENSRNOG00000011567: 94%
Entrez Gene ID: 84881
Uniprot ID: Q96CM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVHVP
• Gene Sequence: NLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVHVP
• Gene ID - Mouse: ENSMUSG00000032044
• Gene ID - Rat: ENSRNOG00000011567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPUSD4 pAb (ATL-HPA039689) – 2 Found

Antonicka, Hana; Choquet, Karine; Lin, Zhen-Yuan; Gingras, Anne-Claude; Kleinman, Claudia L; Shoubridge, Eric A. A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability. Embo Reports. 2017;18(1):28-38. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.