Anti RPS9 pAb (ATL-HPA048746)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048746-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RPS9
Alternative Gene Name: S9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006333: 100%, ENSRNOG00000058909: 100%
Entrez Gene ID: 6203
Uniprot ID: P46781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNA |
| Gene Sequence | ELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNA |
| Gene ID - Mouse | ENSMUSG00000006333 |
| Gene ID - Rat | ENSRNOG00000058909 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPS9 pAb (ATL-HPA048746) | |
| Datasheet | Anti RPS9 pAb (ATL-HPA048746) Datasheet (External Link) |
| Vendor Page | Anti RPS9 pAb (ATL-HPA048746) at Atlas Antibodies |
| Documents & Links for Anti RPS9 pAb (ATL-HPA048746) | |
| Datasheet | Anti RPS9 pAb (ATL-HPA048746) Datasheet (External Link) |
| Vendor Page | Anti RPS9 pAb (ATL-HPA048746) |