Anti RPS9 pAb (ATL-HPA048746)

Atlas Antibodies

Catalog No.:
ATL-HPA048746-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S9
Gene Name: RPS9
Alternative Gene Name: S9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006333: 100%, ENSRNOG00000058909: 100%
Entrez Gene ID: 6203
Uniprot ID: P46781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNA
Gene Sequence ELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNA
Gene ID - Mouse ENSMUSG00000006333
Gene ID - Rat ENSRNOG00000058909
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS9 pAb (ATL-HPA048746)
Datasheet Anti RPS9 pAb (ATL-HPA048746) Datasheet (External Link)
Vendor Page Anti RPS9 pAb (ATL-HPA048746) at Atlas Antibodies

Documents & Links for Anti RPS9 pAb (ATL-HPA048746)
Datasheet Anti RPS9 pAb (ATL-HPA048746) Datasheet (External Link)
Vendor Page Anti RPS9 pAb (ATL-HPA048746)