Anti RPS6KL1 pAb (ATL-HPA027794)

Atlas Antibodies

Catalog No.:
ATL-HPA027794-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S6 kinase-like 1
Gene Name: RPS6KL1
Alternative Gene Name: MGC11287
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019235: 89%, ENSRNOG00000005530: 85%
Entrez Gene ID: 83694
Uniprot ID: Q9Y6S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQAHVYLEQIRNRVALGVPDMTKRDYLVDAATQIRLALERDVSEDYEAAFNHYQNGVDVLLRGIHVDPNKERRE
Gene Sequence SQAHVYLEQIRNRVALGVPDMTKRDYLVDAATQIRLALERDVSEDYEAAFNHYQNGVDVLLRGIHVDPNKERRE
Gene ID - Mouse ENSMUSG00000019235
Gene ID - Rat ENSRNOG00000005530
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS6KL1 pAb (ATL-HPA027794)
Datasheet Anti RPS6KL1 pAb (ATL-HPA027794) Datasheet (External Link)
Vendor Page Anti RPS6KL1 pAb (ATL-HPA027794) at Atlas Antibodies

Documents & Links for Anti RPS6KL1 pAb (ATL-HPA027794)
Datasheet Anti RPS6KL1 pAb (ATL-HPA027794) Datasheet (External Link)
Vendor Page Anti RPS6KL1 pAb (ATL-HPA027794)