Anti RPS6KA6 pAb (ATL-HPA002852)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002852-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RPS6KA6
Alternative Gene Name: RSK4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025665: 91%, ENSRNOG00000002592: 91%
Entrez Gene ID: 27330
Uniprot ID: Q9UK32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK |
Gene Sequence | PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK |
Gene ID - Mouse | ENSMUSG00000025665 |
Gene ID - Rat | ENSRNOG00000002592 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RPS6KA6 pAb (ATL-HPA002852) | |
Datasheet | Anti RPS6KA6 pAb (ATL-HPA002852) Datasheet (External Link) |
Vendor Page | Anti RPS6KA6 pAb (ATL-HPA002852) at Atlas Antibodies |
Documents & Links for Anti RPS6KA6 pAb (ATL-HPA002852) | |
Datasheet | Anti RPS6KA6 pAb (ATL-HPA002852) Datasheet (External Link) |
Vendor Page | Anti RPS6KA6 pAb (ATL-HPA002852) |
Citations for Anti RPS6KA6 pAb (ATL-HPA002852) – 2 Found |
He, Qiancheng; He, Rongquan; Luo, Wenqi; Gan, Xuli; Ma, Jie; Chen, Gang; Li, Ping; Lan, Dong; Hu, Xiaohua. Expression of RSK4 in lung adenocarcinoma tissue and its clinicopathological value: a study based on RNA-seq data and immunohistochemistry. International Journal Of Clinical And Experimental Pathology. 10(12):11405-11414. PubMed |
Zhang, Haitao; Cao, Xiaolei; Tang, Mei; Zhong, Guoxuan; Si, Yuan; Li, Haidong; Zhu, Feifeng; Liao, Qinghua; Li, Liuju; Zhao, Jianhui; Feng, Jia; Li, Shuaifeng; Wang, Chenliang; Kaulich, Manuel; Wang, Fangwei; Chen, Liangyi; Li, Li; Xia, Zongping; Liang, Tingbo; Lu, Huasong; Feng, Xin-Hua; Zhao, Bin. A subcellular map of the human kinome. Elife. 2021;10( 33988507) PubMed |