Anti RPS19BP1 pAb (ATL-HPA042874)

Atlas Antibodies

Catalog No.: ATL-HPA042874-25

Protein Description: ribosomal protein S19 binding protein 1
Gene Name: RPS19BP1
Alternative Gene Name: FLJ21770, MGC52010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051518: 78%, ENSRNOG00000017847: 76%
Entrez Gene ID: 91582
Uniprot ID: Q86WX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
• Gene Sequence: CRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
• Gene ID - Mouse: ENSMUSG00000051518
• Gene ID - Rat: ENSRNOG00000017847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.