Anti RPP30 pAb (ATL-HPA037578 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037578-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RPP30
Alternative Gene Name: TSG15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024800: 87%, ENSRNOG00000018718: 85%
Entrez Gene ID: 10556
Uniprot ID: P78346
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG |
| Gene Sequence | NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG |
| Gene ID - Mouse | ENSMUSG00000024800 |
| Gene ID - Rat | ENSRNOG00000018718 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPP30 pAb (ATL-HPA037578 w/enhanced validation) | |
| Datasheet | Anti RPP30 pAb (ATL-HPA037578 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RPP30 pAb (ATL-HPA037578 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RPP30 pAb (ATL-HPA037578 w/enhanced validation) | |
| Datasheet | Anti RPP30 pAb (ATL-HPA037578 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RPP30 pAb (ATL-HPA037578 w/enhanced validation) |