Anti RPP25 pAb (ATL-HPA046900)

Atlas Antibodies

Catalog No.:
ATL-HPA046900-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribonuclease P/MRP 25kDa subunit
Gene Name: RPP25
Alternative Gene Name: FLJ20374
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062309: 84%, ENSRNOG00000018812: 85%
Entrez Gene ID: 54913
Uniprot ID: Q9BUL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP
Gene Sequence ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP
Gene ID - Mouse ENSMUSG00000062309
Gene ID - Rat ENSRNOG00000018812
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPP25 pAb (ATL-HPA046900)
Datasheet Anti RPP25 pAb (ATL-HPA046900) Datasheet (External Link)
Vendor Page Anti RPP25 pAb (ATL-HPA046900) at Atlas Antibodies

Documents & Links for Anti RPP25 pAb (ATL-HPA046900)
Datasheet Anti RPP25 pAb (ATL-HPA046900) Datasheet (External Link)
Vendor Page Anti RPP25 pAb (ATL-HPA046900)