Anti RPP25 pAb (ATL-HPA046900)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046900-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RPP25
Alternative Gene Name: FLJ20374
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062309: 84%, ENSRNOG00000018812: 85%
Entrez Gene ID: 54913
Uniprot ID: Q9BUL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP |
| Gene Sequence | ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP |
| Gene ID - Mouse | ENSMUSG00000062309 |
| Gene ID - Rat | ENSRNOG00000018812 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPP25 pAb (ATL-HPA046900) | |
| Datasheet | Anti RPP25 pAb (ATL-HPA046900) Datasheet (External Link) |
| Vendor Page | Anti RPP25 pAb (ATL-HPA046900) at Atlas Antibodies |
| Documents & Links for Anti RPP25 pAb (ATL-HPA046900) | |
| Datasheet | Anti RPP25 pAb (ATL-HPA046900) Datasheet (External Link) |
| Vendor Page | Anti RPP25 pAb (ATL-HPA046900) |