Anti RPP25 pAb (ATL-HPA046900)

Atlas Antibodies

SKU: ATL-HPA046900-25

• 
• 
• 

Protein Description: ribonuclease P/MRP 25kDa subunit
Gene Name: RPP25
Alternative Gene Name: FLJ20374
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062309: 84%, ENSRNOG00000018812: 85%
Entrez Gene ID: 54913
Uniprot ID: Q9BUL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP
• Gene Sequence: ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP
• Gene ID - Mouse: ENSMUSG00000062309
• Gene ID - Rat: ENSRNOG00000018812
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.