Anti RPL7A pAb (ATL-HPA046794)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046794-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RPL7A
Alternative Gene Name: L7A, SURF3, TRUP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062647: 100%, ENSRNOG00000047737: 100%
Entrez Gene ID: 6130
Uniprot ID: P62424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLE |
Gene Sequence | EAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLE |
Gene ID - Mouse | ENSMUSG00000062647 |
Gene ID - Rat | ENSRNOG00000047737 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RPL7A pAb (ATL-HPA046794) | |
Datasheet | Anti RPL7A pAb (ATL-HPA046794) Datasheet (External Link) |
Vendor Page | Anti RPL7A pAb (ATL-HPA046794) at Atlas Antibodies |
Documents & Links for Anti RPL7A pAb (ATL-HPA046794) | |
Datasheet | Anti RPL7A pAb (ATL-HPA046794) Datasheet (External Link) |
Vendor Page | Anti RPL7A pAb (ATL-HPA046794) |