Anti RPL7A pAb (ATL-HPA046794)

Atlas Antibodies

Catalog No.:
ATL-HPA046794-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L7a
Gene Name: RPL7A
Alternative Gene Name: L7A, SURF3, TRUP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062647: 100%, ENSRNOG00000047737: 100%
Entrez Gene ID: 6130
Uniprot ID: P62424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLE
Gene Sequence EAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLE
Gene ID - Mouse ENSMUSG00000062647
Gene ID - Rat ENSRNOG00000047737
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL7A pAb (ATL-HPA046794)
Datasheet Anti RPL7A pAb (ATL-HPA046794) Datasheet (External Link)
Vendor Page Anti RPL7A pAb (ATL-HPA046794) at Atlas Antibodies

Documents & Links for Anti RPL7A pAb (ATL-HPA046794)
Datasheet Anti RPL7A pAb (ATL-HPA046794) Datasheet (External Link)
Vendor Page Anti RPL7A pAb (ATL-HPA046794)