Anti RPL5 pAb (ATL-HPA043717)

Atlas Antibodies

Catalog No.: ATL-HPA043717-25

Protein Description: ribosomal protein L5
Gene Name: RPL5
Alternative Gene Name: L5, PPP1R135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058558: 98%, ENSRNOG00000023529: 99%
Entrez Gene ID: 6125
Uniprot ID: P46777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEV
• Gene Sequence: RLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEV
• Gene ID - Mouse: ENSMUSG00000058558
• Gene ID - Rat: ENSRNOG00000023529
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPL5 pAb (ATL-HPA043717) – 1 Found

Zhang, Xingqian; Gao, Xiangwei; Coots, Ryan Alex; Conn, Crystal S; Liu, Botao; Qian, Shu-Bing. Translational control of the cytosolic stress response by mitochondrial ribosomal protein L18. Nature Structural & Molecular Biology. 2015;22(5):404-10.