Anti RPL24 pAb (ATL-HPA051653)

Atlas Antibodies

Catalog No.:
ATL-HPA051653-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L24
Gene Name: RPL24
Alternative Gene Name: L24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098274: 100%, ENSRNOG00000001611: 100%
Entrez Gene ID: 6152
Uniprot ID: P83731
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADI
Gene Sequence FLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADI
Gene ID - Mouse ENSMUSG00000098274
Gene ID - Rat ENSRNOG00000001611
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL24 pAb (ATL-HPA051653)
Datasheet Anti RPL24 pAb (ATL-HPA051653) Datasheet (External Link)
Vendor Page Anti RPL24 pAb (ATL-HPA051653) at Atlas Antibodies

Documents & Links for Anti RPL24 pAb (ATL-HPA051653)
Datasheet Anti RPL24 pAb (ATL-HPA051653) Datasheet (External Link)
Vendor Page Anti RPL24 pAb (ATL-HPA051653)
Citations for Anti RPL24 pAb (ATL-HPA051653) – 1 Found
Knight, John Rp; Vlahov, Nikola; Gay, David M; Ridgway, Rachel A; Faller, William James; Proud, Christopher; Mallucci, Giovanna R; von der Haar, Tobias; Smales, Christopher Mark; Willis, Anne E; Sansom, Owen J. Rpl24(Bst) mutation suppresses colorectal cancer by promoting eEF2 phosphorylation via eEF2K. Elife. 2021;10( 34895463)  PubMed