Anti RPL24 pAb (ATL-HPA051653)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051653-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: RPL24
Alternative Gene Name: L24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098274: 100%, ENSRNOG00000001611: 100%
Entrez Gene ID: 6152
Uniprot ID: P83731
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADI |
| Gene Sequence | FLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADI |
| Gene ID - Mouse | ENSMUSG00000098274 |
| Gene ID - Rat | ENSRNOG00000001611 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPL24 pAb (ATL-HPA051653) | |
| Datasheet | Anti RPL24 pAb (ATL-HPA051653) Datasheet (External Link) |
| Vendor Page | Anti RPL24 pAb (ATL-HPA051653) at Atlas Antibodies |
| Documents & Links for Anti RPL24 pAb (ATL-HPA051653) | |
| Datasheet | Anti RPL24 pAb (ATL-HPA051653) Datasheet (External Link) |
| Vendor Page | Anti RPL24 pAb (ATL-HPA051653) |
| Citations for Anti RPL24 pAb (ATL-HPA051653) – 1 Found |
| Knight, John Rp; Vlahov, Nikola; Gay, David M; Ridgway, Rachel A; Faller, William James; Proud, Christopher; Mallucci, Giovanna R; von der Haar, Tobias; Smales, Christopher Mark; Willis, Anne E; Sansom, Owen J. Rpl24(Bst) mutation suppresses colorectal cancer by promoting eEF2 phosphorylation via eEF2K. Elife. 2021;10( 34895463) PubMed |