Anti RPL23 pAb (ATL-HPA003373)

Atlas Antibodies

Catalog No.:
ATL-HPA003373-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L23
Gene Name: RPL23
Alternative Gene Name: L23, rpL17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071415: 100%, ENSRNOG00000004107: 100%
Entrez Gene ID: 9349
Uniprot ID: P62829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV
Gene Sequence ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV
Gene ID - Mouse ENSMUSG00000071415
Gene ID - Rat ENSRNOG00000004107
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL23 pAb (ATL-HPA003373)
Datasheet Anti RPL23 pAb (ATL-HPA003373) Datasheet (External Link)
Vendor Page Anti RPL23 pAb (ATL-HPA003373) at Atlas Antibodies

Documents & Links for Anti RPL23 pAb (ATL-HPA003373)
Datasheet Anti RPL23 pAb (ATL-HPA003373) Datasheet (External Link)
Vendor Page Anti RPL23 pAb (ATL-HPA003373)
Citations for Anti RPL23 pAb (ATL-HPA003373) – 1 Found
van der Meeren, L E; Kluiver, J; Rutgers, B; Alsagoor, Y; Kluin, P M; van den Berg, A; Visser, L. A super-SILAC based proteomics analysis of diffuse large B-cell lymphoma-NOS patient samples to identify new proteins that discriminate GCB and non-GCB lymphomas. Plos One. 14(10):e0223260.  PubMed