Anti RPL23 pAb (ATL-HPA003373)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003373-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RPL23
Alternative Gene Name: L23, rpL17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071415: 100%, ENSRNOG00000004107: 100%
Entrez Gene ID: 9349
Uniprot ID: P62829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV |
| Gene Sequence | ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV |
| Gene ID - Mouse | ENSMUSG00000071415 |
| Gene ID - Rat | ENSRNOG00000004107 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPL23 pAb (ATL-HPA003373) | |
| Datasheet | Anti RPL23 pAb (ATL-HPA003373) Datasheet (External Link) |
| Vendor Page | Anti RPL23 pAb (ATL-HPA003373) at Atlas Antibodies |
| Documents & Links for Anti RPL23 pAb (ATL-HPA003373) | |
| Datasheet | Anti RPL23 pAb (ATL-HPA003373) Datasheet (External Link) |
| Vendor Page | Anti RPL23 pAb (ATL-HPA003373) |
| Citations for Anti RPL23 pAb (ATL-HPA003373) – 1 Found |
| van der Meeren, L E; Kluiver, J; Rutgers, B; Alsagoor, Y; Kluin, P M; van den Berg, A; Visser, L. A super-SILAC based proteomics analysis of diffuse large B-cell lymphoma-NOS patient samples to identify new proteins that discriminate GCB and non-GCB lymphomas. Plos One. 14(10):e0223260. PubMed |