Anti RPL18 pAb (ATL-HPA046572)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046572-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RPL18
Alternative Gene Name: L18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059070: 95%, ENSRNOG00000021035: 95%
Entrez Gene ID: 6141
Uniprot ID: Q07020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERAR |
| Gene Sequence | KLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERAR |
| Gene ID - Mouse | ENSMUSG00000059070 |
| Gene ID - Rat | ENSRNOG00000021035 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPL18 pAb (ATL-HPA046572) | |
| Datasheet | Anti RPL18 pAb (ATL-HPA046572) Datasheet (External Link) |
| Vendor Page | Anti RPL18 pAb (ATL-HPA046572) at Atlas Antibodies |
| Documents & Links for Anti RPL18 pAb (ATL-HPA046572) | |
| Datasheet | Anti RPL18 pAb (ATL-HPA046572) Datasheet (External Link) |
| Vendor Page | Anti RPL18 pAb (ATL-HPA046572) |
| Citations for Anti RPL18 pAb (ATL-HPA046572) – 1 Found |
| Wollen, Kristian Lied; Hagen, Lars; Vågbø, Cathrine B; Rabe, Renana; Iveland, Tobias S; Aas, Per Arne; Sharma, Animesh; Sporsheim, Bjørnar; Erlandsen, Hilde O; Palibrk, Vuk; Bjørås, Magnar; Fonseca, Davi M; Mosammaparast, Nima; Slupphaug, Geir. ALKBH3 partner ASCC3 mediates P-body formation and selective clearance of MMS-induced 1-methyladenosine and 3-methylcytosine from mRNA. Journal Of Translational Medicine. 2021;19(1):287. PubMed |