Anti RPL18 pAb (ATL-HPA046572)

Atlas Antibodies

Catalog No.: ATL-HPA046572-25

Protein Description: ribosomal protein L18
Gene Name: RPL18
Alternative Gene Name: L18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059070: 95%, ENSRNOG00000021035: 95%
Entrez Gene ID: 6141
Uniprot ID: Q07020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERAR
• Gene Sequence: KLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERAR
• Gene ID - Mouse: ENSMUSG00000059070
• Gene ID - Rat: ENSRNOG00000021035
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPL18 pAb (ATL-HPA046572) – 1 Found

Wollen, Kristian Lied; Hagen, Lars; Vågbø, Cathrine B; Rabe, Renana; Iveland, Tobias S; Aas, Per Arne; Sharma, Animesh; Sporsheim, Bjørnar; Erlandsen, Hilde O; Palibrk, Vuk; Bjørås, Magnar; Fonseca, Davi M; Mosammaparast, Nima; Slupphaug, Geir. ALKBH3 partner ASCC3 mediates P-body formation and selective clearance of MMS-induced 1-methyladenosine and 3-methylcytosine from mRNA. Journal Of Translational Medicine. 2021;19(1):287.