Anti RPIA pAb (ATL-HPA042620 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042620-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RPIA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053604: 94%, ENSRNOG00000005576: 94%
Entrez Gene ID: 22934
Uniprot ID: P49247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAID |
| Gene Sequence | AVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAID |
| Gene ID - Mouse | ENSMUSG00000053604 |
| Gene ID - Rat | ENSRNOG00000005576 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPIA pAb (ATL-HPA042620 w/enhanced validation) | |
| Datasheet | Anti RPIA pAb (ATL-HPA042620 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RPIA pAb (ATL-HPA042620 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RPIA pAb (ATL-HPA042620 w/enhanced validation) | |
| Datasheet | Anti RPIA pAb (ATL-HPA042620 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RPIA pAb (ATL-HPA042620 w/enhanced validation) |
| Citations for Anti RPIA pAb (ATL-HPA042620 w/enhanced validation) – 1 Found |
| Calvo-Vidal, M Nieves; Zamponi, Nahuel; Krumsiek, Jan; Stockslager, Max A; Revuelta, Maria V; Phillip, Jude M; Marullo, Rossella; Tikhonova, Ekaterina; Kotlov, Nikita; Patel, Jayeshkumar; Yang, Shao Ning; Yang, Lucy; Taldone, Tony; Thieblemont, Catherine; Leonard, John P; Martin, Peter; Inghirami, Giorgio; Chiosis, Gabriela; Manalis, Scott R; Cerchietti, Leandro. Oncogenic HSP90 Facilitates Metabolic Alterations in Aggressive B-cell Lymphomas. Cancer Research. 2021;81(20):5202-5216. PubMed |