Anti RPA3 pAb (ATL-HPA005708)

Atlas Antibodies

Catalog No.: ATL-HPA005708-25

Protein Description: replication protein A3, 14kDa
Gene Name: RPA3
Alternative Gene Name: REPA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012483: 79%, ENSRNOG00000008309: 81%
Entrez Gene ID: 6119
Uniprot ID: P35244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYP
• Gene Sequence: VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYP
• Gene ID - Mouse: ENSMUSG00000012483
• Gene ID - Rat: ENSRNOG00000008309
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPA3 pAb (ATL-HPA005708) – 2 Found

Hewings, David S; Heideker, Johanna; Ma, Taylur P; AhYoung, Andrew P; El Oualid, Farid; Amore, Alessia; Costakes, Gregory T; Kirchhofer, Daniel; Brasher, Bradley; Pillow, Thomas; Popovych, Nataliya; Maurer, Till; Schwerdtfeger, Carsten; Forrest, William F; Yu, Kebing; Flygare, John; Bogyo, Matthew; Wertz, Ingrid E. Reactive-site-centric chemoproteomics identifies a distinct class of deubiquitinase enzymes. Nature Communications. 2018;9(1):1162. 

Shorrocks, Ann-Marie K; Jones, Samuel E; Tsukada, Kaima; Morrow, Carl A; Belblidia, Zoulikha; Shen, Johanna; Vendrell, Iolanda; Fischer, Roman; Kessler, Benedikt M; Blackford, Andrew N. The Bloom syndrome complex senses RPA-coated single-stranded DNA to restart stalled replication forks. Nature Communications. 2021;12(1):585.