Anti ROS1 pAb (ATL-HPA072424)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072424-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ROS1
Alternative Gene Name: c-ros-1, MCF3, ROS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019893: 68%, ENSRNOG00000000406: 66%
Entrez Gene ID: 6098
Uniprot ID: P08922
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DVICLNSDDIMPVALMETKNREGLNYMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNYACLTHSGYGDGSD |
Gene Sequence | DVICLNSDDIMPVALMETKNREGLNYMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNYACLTHSGYGDGSD |
Gene ID - Mouse | ENSMUSG00000019893 |
Gene ID - Rat | ENSRNOG00000000406 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ROS1 pAb (ATL-HPA072424) | |
Datasheet | Anti ROS1 pAb (ATL-HPA072424) Datasheet (External Link) |
Vendor Page | Anti ROS1 pAb (ATL-HPA072424) at Atlas Antibodies |
Documents & Links for Anti ROS1 pAb (ATL-HPA072424) | |
Datasheet | Anti ROS1 pAb (ATL-HPA072424) Datasheet (External Link) |
Vendor Page | Anti ROS1 pAb (ATL-HPA072424) |