Anti ROCK1 pAb (ATL-HPA045639)

Atlas Antibodies

Catalog No.:
ATL-HPA045639-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Rho-associated, coiled-coil containing protein kinase 1
Gene Name: ROCK1
Alternative Gene Name: p160ROCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024290: 97%, ENSRNOG00000031092: 97%
Entrez Gene ID: 6093
Uniprot ID: Q13464
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEDLICPCKVSYDVTSARDMLLLACSQDEQ
Gene Sequence KEDLICPCKVSYDVTSARDMLLLACSQDEQ
Gene ID - Mouse ENSMUSG00000024290
Gene ID - Rat ENSRNOG00000031092
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ROCK1 pAb (ATL-HPA045639)
Datasheet Anti ROCK1 pAb (ATL-HPA045639) Datasheet (External Link)
Vendor Page Anti ROCK1 pAb (ATL-HPA045639) at Atlas Antibodies

Documents & Links for Anti ROCK1 pAb (ATL-HPA045639)
Datasheet Anti ROCK1 pAb (ATL-HPA045639) Datasheet (External Link)
Vendor Page Anti ROCK1 pAb (ATL-HPA045639)