Anti ROCK1 pAb (ATL-HPA007567 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007567-25

Protein Description: Rho-associated, coiled-coil containing protein kinase 1
Gene Name: ROCK1
Alternative Gene Name: p160ROCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024290: 89%, ENSRNOG00000031092: 90%
Entrez Gene ID: 6093
Uniprot ID: Q13464
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERT
• Gene Sequence: TQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERT
• Gene ID - Mouse: ENSMUSG00000024290
• Gene ID - Rat: ENSRNOG00000031092
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ROCK1 pAb (ATL-HPA007567 w/enhanced validation) – 4 Found

Zanin-Zhorov, Alexandra; Weiss, Jonathan M; Trzeciak, Alissa; Chen, Wei; Zhang, Jingya; Nyuydzefe, Melanie S; Arencibia, Carmen; Polimera, Seetharam; Schueller, Olivier; Fuentes-Duculan, Judilyn; Bonifacio, Kathleen M; Kunjravia, Norma; Cueto, Inna; Soung, Jennifer; Fleischmann, Roy M; Kivitz, Alan; Lebwohl, Mark; Nunez, Margarita; Woodson, Johnnie; Smith, Shondra L; West, Robert F; Berger, Mark; Krueger, James G; Ryan, John L; Waksal, Samuel D. Cutting Edge: Selective Oral ROCK2 Inhibitor Reduces Clinical Scores in Patients with Psoriasis Vulgaris and Normalizes Skin Pathology via Concurrent Regulation of IL-17 and IL-10. Journal Of Immunology (Baltimore, Md. : 1950). 2017;198(10):3809-3814. 

Ito, Shoko; Okuda, Satoru; Abe, Masako; Fujimoto, Mari; Onuki, Tetsuo; Nishimura, Tamako; Takeichi, Masatoshi. Induced cortical tension restores functional junctions in adhesion-defective carcinoma cells. Nature Communications. 2017;8(1):1834. 

Tanaka, Keiichi; Matsumoto, Yoshitaka; Ishikawa, Hitoshi; Fukumitsu, Nobuyoshi; Numajiri, Haruko; Murofushi, Keiko; Oshiro, Yoshiko; Okumura, Toshiyuki; Satoh, Toyomi; Sakurai, Hideyuki. Impact of RhoA overexpression on clinical outcomes in cervical squamous cell carcinoma treated with concurrent chemoradiotherapy. Journal Of Radiation Research. 2020;61(2):221-230. 

Agostinucci, Kevin; Hutcheson, Rebecca; Hossain, Sakib; Pascale, Jonathan V; Villegas, Elizabeth; Zhang, Frank; Adebesin, Adeniyi Michael; Falck, John R; Gupte, Sachin; Garcia, Victor; Schwartzman, Michal Laniado. Blockade of 20-hydroxyeicosatetraenoic acid receptor lowers blood pressure and alters vascular function in mice with smooth muscle-specific overexpression of CYP4A12-20-HETE synthase. Journal Of Hypertension. 2022;40(3):498-511.