Anti RNPEP pAb (ATL-HPA036074)

Atlas Antibodies

Catalog No.:
ATL-HPA036074-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: arginyl aminopeptidase (aminopeptidase B)
Gene Name: RNPEP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041926: 87%, ENSRNOG00000006720: 90%
Entrez Gene ID: 6051
Uniprot ID: Q9H4A4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQI
Gene Sequence MKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQI
Gene ID - Mouse ENSMUSG00000041926
Gene ID - Rat ENSRNOG00000006720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNPEP pAb (ATL-HPA036074)
Datasheet Anti RNPEP pAb (ATL-HPA036074) Datasheet (External Link)
Vendor Page Anti RNPEP pAb (ATL-HPA036074) at Atlas Antibodies

Documents & Links for Anti RNPEP pAb (ATL-HPA036074)
Datasheet Anti RNPEP pAb (ATL-HPA036074) Datasheet (External Link)
Vendor Page Anti RNPEP pAb (ATL-HPA036074)
Citations for Anti RNPEP pAb (ATL-HPA036074) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed