Anti RNF19A pAb (ATL-HPA023652)

Atlas Antibodies

Catalog No.: ATL-HPA023652-25

Protein Description: ring finger protein 19A, RBR E3 ubiquitin protein ligase
Gene Name: RNF19A
Alternative Gene Name: DKFZp566B1346, dorfin, RNF19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022280: 98%, ENSRNOG00000009658: 93%
Entrez Gene ID: 25897
Uniprot ID: Q9NV58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL
• Gene Sequence: EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL
• Gene ID - Mouse: ENSMUSG00000022280
• Gene ID - Rat: ENSRNOG00000009658
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.