Anti RNF182 pAb (ATL-HPA012309)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012309-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: RNF182
Alternative Gene Name: MGC33993
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044164: 100%, ENSRNOG00000018070: 99%
Entrez Gene ID: 221687
Uniprot ID: Q8N6D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLL |
| Gene Sequence | VLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLL |
| Gene ID - Mouse | ENSMUSG00000044164 |
| Gene ID - Rat | ENSRNOG00000018070 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF182 pAb (ATL-HPA012309) | |
| Datasheet | Anti RNF182 pAb (ATL-HPA012309) Datasheet (External Link) |
| Vendor Page | Anti RNF182 pAb (ATL-HPA012309) at Atlas Antibodies |
| Documents & Links for Anti RNF182 pAb (ATL-HPA012309) | |
| Datasheet | Anti RNF182 pAb (ATL-HPA012309) Datasheet (External Link) |
| Vendor Page | Anti RNF182 pAb (ATL-HPA012309) |