Anti RNF182 pAb (ATL-HPA012309)

Atlas Antibodies

Catalog No.:
ATL-HPA012309-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ring finger protein 182
Gene Name: RNF182
Alternative Gene Name: MGC33993
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044164: 100%, ENSRNOG00000018070: 99%
Entrez Gene ID: 221687
Uniprot ID: Q8N6D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLL
Gene Sequence VLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLL
Gene ID - Mouse ENSMUSG00000044164
Gene ID - Rat ENSRNOG00000018070
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF182 pAb (ATL-HPA012309)
Datasheet Anti RNF182 pAb (ATL-HPA012309) Datasheet (External Link)
Vendor Page Anti RNF182 pAb (ATL-HPA012309) at Atlas Antibodies

Documents & Links for Anti RNF182 pAb (ATL-HPA012309)
Datasheet Anti RNF182 pAb (ATL-HPA012309) Datasheet (External Link)
Vendor Page Anti RNF182 pAb (ATL-HPA012309)