Anti RNF169 pAb (ATL-HPA046138)

Atlas Antibodies

Catalog No.:
ATL-HPA046138-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 169
Gene Name: RNF169
Alternative Gene Name: KIAA1991
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058761: 77%, ENSRNOG00000026408: 74%
Entrez Gene ID: 254225
Uniprot ID: Q8NCN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSGTSLEREQFEGLGSTPDAKLDKTCISRAMKITTVNSVLPQNSVLGGVLKTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRHCKTKHLEQ
Gene Sequence GSGTSLEREQFEGLGSTPDAKLDKTCISRAMKITTVNSVLPQNSVLGGVLKTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRHCKTKHLEQ
Gene ID - Mouse ENSMUSG00000058761
Gene ID - Rat ENSRNOG00000026408
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF169 pAb (ATL-HPA046138)
Datasheet Anti RNF169 pAb (ATL-HPA046138) Datasheet (External Link)
Vendor Page Anti RNF169 pAb (ATL-HPA046138) at Atlas Antibodies

Documents & Links for Anti RNF169 pAb (ATL-HPA046138)
Datasheet Anti RNF169 pAb (ATL-HPA046138) Datasheet (External Link)
Vendor Page Anti RNF169 pAb (ATL-HPA046138)