Anti RNF168 pAb (ATL-HPA046109)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046109-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RNF168
Alternative Gene Name: FLJ35794
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014074: 43%, ENSRNOG00000043345: 42%
Entrez Gene ID: 165918
Uniprot ID: Q8IYW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGK |
| Gene Sequence | LTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGK |
| Gene ID - Mouse | ENSMUSG00000014074 |
| Gene ID - Rat | ENSRNOG00000043345 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF168 pAb (ATL-HPA046109) | |
| Datasheet | Anti RNF168 pAb (ATL-HPA046109) Datasheet (External Link) |
| Vendor Page | Anti RNF168 pAb (ATL-HPA046109) at Atlas Antibodies |
| Documents & Links for Anti RNF168 pAb (ATL-HPA046109) | |
| Datasheet | Anti RNF168 pAb (ATL-HPA046109) Datasheet (External Link) |
| Vendor Page | Anti RNF168 pAb (ATL-HPA046109) |