Anti RNF165 pAb (ATL-HPA047798)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047798-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNF165
Alternative Gene Name: ARKL2, RNF111L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025427: 99%, ENSRNOG00000048824: 99%
Entrez Gene ID: 494470
Uniprot ID: Q6ZSG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGK |
| Gene Sequence | VVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGK |
| Gene ID - Mouse | ENSMUSG00000025427 |
| Gene ID - Rat | ENSRNOG00000048824 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF165 pAb (ATL-HPA047798) | |
| Datasheet | Anti RNF165 pAb (ATL-HPA047798) Datasheet (External Link) |
| Vendor Page | Anti RNF165 pAb (ATL-HPA047798) at Atlas Antibodies |
| Documents & Links for Anti RNF165 pAb (ATL-HPA047798) | |
| Datasheet | Anti RNF165 pAb (ATL-HPA047798) Datasheet (External Link) |
| Vendor Page | Anti RNF165 pAb (ATL-HPA047798) |