Anti RNF146 pAb (ATL-HPA027158)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027158-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNF146
Alternative Gene Name: dactylidin, dJ351K20.1, DKFZp434O1427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038876: 100%, ENSRNOG00000011588: 99%
Entrez Gene ID: 81847
Uniprot ID: Q9NTX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLEN |
| Gene Sequence | IPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLEN |
| Gene ID - Mouse | ENSMUSG00000038876 |
| Gene ID - Rat | ENSRNOG00000011588 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF146 pAb (ATL-HPA027158) | |
| Datasheet | Anti RNF146 pAb (ATL-HPA027158) Datasheet (External Link) |
| Vendor Page | Anti RNF146 pAb (ATL-HPA027158) at Atlas Antibodies |
| Documents & Links for Anti RNF146 pAb (ATL-HPA027158) | |
| Datasheet | Anti RNF146 pAb (ATL-HPA027158) Datasheet (External Link) |
| Vendor Page | Anti RNF146 pAb (ATL-HPA027158) |