Anti RNF146 pAb (ATL-HPA027158)

Atlas Antibodies

Catalog No.: ATL-HPA027158-25

Protein Description: ring finger protein 146
Gene Name: RNF146
Alternative Gene Name: dactylidin, dJ351K20.1, DKFZp434O1427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038876: 100%, ENSRNOG00000011588: 99%
Entrez Gene ID: 81847
Uniprot ID: Q9NTX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLEN
• Gene Sequence: IPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLEN
• Gene ID - Mouse: ENSMUSG00000038876
• Gene ID - Rat: ENSRNOG00000011588
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.