Anti RNF112 pAb (ATL-HPA015970)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015970-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RNF112
Alternative Gene Name: BFP, ZNF179
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010086: 93%, ENSRNOG00000002364: 92%
Entrez Gene ID: 7732
Uniprot ID: Q9ULX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT |
Gene Sequence | LAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT |
Gene ID - Mouse | ENSMUSG00000010086 |
Gene ID - Rat | ENSRNOG00000002364 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF112 pAb (ATL-HPA015970) | |
Datasheet | Anti RNF112 pAb (ATL-HPA015970) Datasheet (External Link) |
Vendor Page | Anti RNF112 pAb (ATL-HPA015970) at Atlas Antibodies |
Documents & Links for Anti RNF112 pAb (ATL-HPA015970) | |
Datasheet | Anti RNF112 pAb (ATL-HPA015970) Datasheet (External Link) |
Vendor Page | Anti RNF112 pAb (ATL-HPA015970) |