Anti RNF112 pAb (ATL-HPA015970)

Atlas Antibodies

Catalog No.:
ATL-HPA015970-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 112
Gene Name: RNF112
Alternative Gene Name: BFP, ZNF179
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010086: 93%, ENSRNOG00000002364: 92%
Entrez Gene ID: 7732
Uniprot ID: Q9ULX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT
Gene Sequence LAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT
Gene ID - Mouse ENSMUSG00000010086
Gene ID - Rat ENSRNOG00000002364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF112 pAb (ATL-HPA015970)
Datasheet Anti RNF112 pAb (ATL-HPA015970) Datasheet (External Link)
Vendor Page Anti RNF112 pAb (ATL-HPA015970) at Atlas Antibodies

Documents & Links for Anti RNF112 pAb (ATL-HPA015970)
Datasheet Anti RNF112 pAb (ATL-HPA015970) Datasheet (External Link)
Vendor Page Anti RNF112 pAb (ATL-HPA015970)