Anti RNF111 pAb (ATL-HPA038577)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038577-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNF111
Alternative Gene Name: ARK, Arkadia, DKFZP761D081, FLJ38008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032217: 81%, ENSRNOG00000060750: 86%
Entrez Gene ID: 54778
Uniprot ID: Q6ZNA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPC |
| Gene Sequence | GTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPC |
| Gene ID - Mouse | ENSMUSG00000032217 |
| Gene ID - Rat | ENSRNOG00000060750 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF111 pAb (ATL-HPA038577) | |
| Datasheet | Anti RNF111 pAb (ATL-HPA038577) Datasheet (External Link) |
| Vendor Page | Anti RNF111 pAb (ATL-HPA038577) at Atlas Antibodies |
| Documents & Links for Anti RNF111 pAb (ATL-HPA038577) | |
| Datasheet | Anti RNF111 pAb (ATL-HPA038577) Datasheet (External Link) |
| Vendor Page | Anti RNF111 pAb (ATL-HPA038577) |