Anti RNF111 pAb (ATL-HPA038577)

Atlas Antibodies

Catalog No.:
ATL-HPA038577-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 111
Gene Name: RNF111
Alternative Gene Name: ARK, Arkadia, DKFZP761D081, FLJ38008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032217: 81%, ENSRNOG00000060750: 86%
Entrez Gene ID: 54778
Uniprot ID: Q6ZNA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen GTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPC
Gene Sequence GTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPC
Gene ID - Mouse ENSMUSG00000032217
Gene ID - Rat ENSRNOG00000060750
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF111 pAb (ATL-HPA038577)
Datasheet Anti RNF111 pAb (ATL-HPA038577) Datasheet (External Link)
Vendor Page Anti RNF111 pAb (ATL-HPA038577) at Atlas Antibodies

Documents & Links for Anti RNF111 pAb (ATL-HPA038577)
Datasheet Anti RNF111 pAb (ATL-HPA038577) Datasheet (External Link)
Vendor Page Anti RNF111 pAb (ATL-HPA038577)