Anti RMND5B pAb (ATL-HPA047778)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047778-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RMND5B
Alternative Gene Name: FLJ22318, GID2, GID2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001054: 96%, ENSRNOG00000047719: 96%
Entrez Gene ID: 64777
Uniprot ID: Q96G75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVA |
Gene Sequence | AIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVA |
Gene ID - Mouse | ENSMUSG00000001054 |
Gene ID - Rat | ENSRNOG00000047719 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RMND5B pAb (ATL-HPA047778) | |
Datasheet | Anti RMND5B pAb (ATL-HPA047778) Datasheet (External Link) |
Vendor Page | Anti RMND5B pAb (ATL-HPA047778) at Atlas Antibodies |
Documents & Links for Anti RMND5B pAb (ATL-HPA047778) | |
Datasheet | Anti RMND5B pAb (ATL-HPA047778) Datasheet (External Link) |
Vendor Page | Anti RMND5B pAb (ATL-HPA047778) |