Anti RMND5B pAb (ATL-HPA047778)

Atlas Antibodies

Catalog No.:
ATL-HPA047778-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: required for meiotic nuclear division 5 homolog B (S. cerevisiae)
Gene Name: RMND5B
Alternative Gene Name: FLJ22318, GID2, GID2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001054: 96%, ENSRNOG00000047719: 96%
Entrez Gene ID: 64777
Uniprot ID: Q96G75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVA
Gene Sequence AIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVA
Gene ID - Mouse ENSMUSG00000001054
Gene ID - Rat ENSRNOG00000047719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RMND5B pAb (ATL-HPA047778)
Datasheet Anti RMND5B pAb (ATL-HPA047778) Datasheet (External Link)
Vendor Page Anti RMND5B pAb (ATL-HPA047778) at Atlas Antibodies

Documents & Links for Anti RMND5B pAb (ATL-HPA047778)
Datasheet Anti RMND5B pAb (ATL-HPA047778) Datasheet (External Link)
Vendor Page Anti RMND5B pAb (ATL-HPA047778)