Anti RMND5A pAb (ATL-HPA046795)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046795-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RMND5A
Alternative Gene Name: FLJ13910, GID2, GID2A, RMD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002222: 100%, ENSRNOG00000028422: 100%
Entrez Gene ID: 64795
Uniprot ID: Q9H871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE |
| Gene Sequence | FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE |
| Gene ID - Mouse | ENSMUSG00000002222 |
| Gene ID - Rat | ENSRNOG00000028422 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RMND5A pAb (ATL-HPA046795) | |
| Datasheet | Anti RMND5A pAb (ATL-HPA046795) Datasheet (External Link) |
| Vendor Page | Anti RMND5A pAb (ATL-HPA046795) at Atlas Antibodies |
| Documents & Links for Anti RMND5A pAb (ATL-HPA046795) | |
| Datasheet | Anti RMND5A pAb (ATL-HPA046795) Datasheet (External Link) |
| Vendor Page | Anti RMND5A pAb (ATL-HPA046795) |