Anti RMND5A pAb (ATL-HPA046795)

Atlas Antibodies

Catalog No.:
ATL-HPA046795-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: required for meiotic nuclear division 5 homolog A (S. cerevisiae)
Gene Name: RMND5A
Alternative Gene Name: FLJ13910, GID2, GID2A, RMD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002222: 100%, ENSRNOG00000028422: 100%
Entrez Gene ID: 64795
Uniprot ID: Q9H871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE
Gene Sequence FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE
Gene ID - Mouse ENSMUSG00000002222
Gene ID - Rat ENSRNOG00000028422
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RMND5A pAb (ATL-HPA046795)
Datasheet Anti RMND5A pAb (ATL-HPA046795) Datasheet (External Link)
Vendor Page Anti RMND5A pAb (ATL-HPA046795) at Atlas Antibodies

Documents & Links for Anti RMND5A pAb (ATL-HPA046795)
Datasheet Anti RMND5A pAb (ATL-HPA046795) Datasheet (External Link)
Vendor Page Anti RMND5A pAb (ATL-HPA046795)