Anti RICTOR pAb (ATL-HPA037803)

Atlas Antibodies

Catalog No.: ATL-HPA037803-25

Protein Description: RPTOR independent companion of MTOR, complex 2
Gene Name: RICTOR
Alternative Gene Name: AVO3, KIAA1999, MGC39830, PIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050310: 95%, ENSRNOG00000011341: 96%
Entrez Gene ID: 253260
Uniprot ID: Q6R327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDK
• Gene Sequence: LNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDK
• Gene ID - Mouse: ENSMUSG00000050310
• Gene ID - Rat: ENSRNOG00000011341
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.