Anti RICTOR pAb (ATL-HPA037803)

Atlas Antibodies

Catalog No.:
ATL-HPA037803-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: RPTOR independent companion of MTOR, complex 2
Gene Name: RICTOR
Alternative Gene Name: AVO3, KIAA1999, MGC39830, PIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050310: 95%, ENSRNOG00000011341: 96%
Entrez Gene ID: 253260
Uniprot ID: Q6R327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDK
Gene Sequence LNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDK
Gene ID - Mouse ENSMUSG00000050310
Gene ID - Rat ENSRNOG00000011341
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RICTOR pAb (ATL-HPA037803)
Datasheet Anti RICTOR pAb (ATL-HPA037803) Datasheet (External Link)
Vendor Page Anti RICTOR pAb (ATL-HPA037803) at Atlas Antibodies

Documents & Links for Anti RICTOR pAb (ATL-HPA037803)
Datasheet Anti RICTOR pAb (ATL-HPA037803) Datasheet (External Link)
Vendor Page Anti RICTOR pAb (ATL-HPA037803)