Anti RHOBTB1 pAb (ATL-HPA040226)

Atlas Antibodies

Catalog No.: ATL-HPA040226-25

Protein Description: Rho-related BTB domain containing 1
Gene Name: RHOBTB1
Alternative Gene Name: KIAA0740
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019944: 76%, ENSRNOG00000000633: 77%
Entrez Gene ID: 9886
Uniprot ID: O94844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYTGQLDEKEKDLVGLAQIAEVLEM
• Gene Sequence: TQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYTGQLDEKEKDLVGLAQIAEVLEM
• Gene ID - Mouse: ENSMUSG00000019944
• Gene ID - Rat: ENSRNOG00000000633
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.