Anti RHO pAb (ATL-HPA013440)

Atlas Antibodies

Catalog No.:
ATL-HPA013440-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: rhodopsin
Gene Name: RHO
Alternative Gene Name: CSNBAD1, OPN2, RP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030324: 95%, ENSRNOG00000011144: 95%
Entrez Gene ID: 6010
Uniprot ID: P08100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFS
Gene Sequence MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFS
Gene ID - Mouse ENSMUSG00000030324
Gene ID - Rat ENSRNOG00000011144
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHO pAb (ATL-HPA013440)
Datasheet Anti RHO pAb (ATL-HPA013440) Datasheet (External Link)
Vendor Page Anti RHO pAb (ATL-HPA013440) at Atlas Antibodies

Documents & Links for Anti RHO pAb (ATL-HPA013440)
Datasheet Anti RHO pAb (ATL-HPA013440) Datasheet (External Link)
Vendor Page Anti RHO pAb (ATL-HPA013440)